www.cleansweepchimneyservicesllc.com - Detailed Indepth Information and Report for www.cleansweepchimneyservicesllc.com server location, www.cleansweepchimneyservicesllc.com website speed, www.cleansweepchimneyservicesllc.com website DNS lookup, www.cleansweepchimneyservicesllc.com Domain Details,www.cleansweepchimneyservicesllc.com social account information, etc. Complete Analysis of www.cleansweepchimneyservicesllc.com SEO like Meta Tags, Meta Keywords, Description, image count etc.
Web Analysis for cleansweepchimneyservicesllc - www.cleansweepchimneyservicesllc.com
| Page URL : | https://www.cleansweepchimneyservicesllc.com/ |
|---|---|
| Page Download Size : | 14.1758 Kb |
| Page Load Time : | 0.0293 Sec |
| Download Speed : | 0.4725 Mbps |
Count on Clean Sweep Chimney Services for all your chimney sweep needs, including fireplace and dryer vent cleaning, in York, Gettysburg, Carlisle PA and surrounding areas..During our test, www.cleansweepchimneyservicesllc.com was downloaded in 0.0293 seconds. The homepage of the website is of 14.1758 Kb. The homepage was downloaded at the speed of 0.4725 Mbps, which is on the lower side.
www.cleansweepchimneyservicesllc.com business details :
We could not found details of the business associated with the website www.cleansweepchimneyservicesllc.com
Website Rank & Score to cleansweepchimneyservicesllc.com by Global & Country
The AuraStats, which measures best global as well country Alexa ranking performace of www.cleansweepchimneyservicesllc.com. www.cleansweepchimneyservicesllc.com ranks is not applicable. www.cleansweepchimneyservicesllc.com is not a top rated website as per Alexa Ranking. The website www.cleansweepchimneyservicesllc.com does not rank amongst top 1 million websites globally or in its country.
| Global Alexa Rank | Not Applicable |
|---|---|
| Country Alexa Rank | Not Applicable |
Web Server Information - www.cleansweepchimneyservicesllc.com
cleansweepchimneyservicesllc.com is hosted on Server 216.70.123.129 in Media Temple Inc. Data Center. Approximate latitude and logitude of the IP 216.70.123.129 are 34.017185211182 and -118.39282989502 respectively. cleansweepchimneyservicesllc.com is hosted in Culver City, California, United States.
| Hosted IP Address | 216.70.123.129 |
|---|---|
| Hosted Country | United States |
| Location Latitude | 34.017185211182 |
| Location Longitude | -118.39282989502 |
| Server ISP | Media Temple Inc. |
| Server Region | California |
| Server City | Culver City |
Page Title of www.cleansweepchimneyservicesllc.com
Chimney Cleaning, Sweep | Hanover, York, Carlisle PA | Repairs | Clean Sweep Chimney Services, LLC
Meta Tags of www.cleansweepchimneyservicesllc.com
Upon analysing the homepage of www.cleansweepchimneyservicesllc.com, we found that no meta keywords were present.
Meta Viewport of www.cleansweepchimneyservicesllc.com is Mobile Optimized.
We could not find Meta Author, Meta Generator, Meta Framework, Meta Theme-Color, Meta Ms-App, Meta Format Detection for www.cleansweepchimneyservicesllc.com
| Meta Keywords | Not Applicable |
|---|---|
| Meta Author | Not Applicable |
| Meta Generator | Not Applicable |
| Meta Viewport | Mobile Optimized |
| Meta Framework | Not Applicable |
| Meta Theme Color | Not Applicable |
| Meta MS-App | Not Applicable |
| Meta Format Detection | Not Applicable |
Social Accounts
We could not find Facebook URL, Youtube URL, Instagram URL, Lindedin URL for www.cleansweepchimneyservicesllc.com
| Facebook Link |
|---|
| Not Available |
| Youtube Link |
| Not Available |
| Instagram Link |
| Not Available |
| Linkedin Link |
| Not Available |
Contact Information - cleansweepchimneyservicesllc.com
| Contact Number |
|---|
| We could not find any contact number for cleansweepchimneyservicesllc.com. To find contact number of cleansweepchimneyservicesllc.com, we recommend you visit cleansweepchimneyservicesllc.com and find it there. |
| Email Address |
|---|
| We found the Email ID for cleansweepchimneyservicesllc.com as follows. |
| [email protected] |
Domain TYPOS
Some common domain name typos of cleansweepchimneyservicesllc.com are as follows:
Website Inpage Analysis
We didn't find any H4 Tags, H5 Tags, H6 Tags, Iframe Tags, Audio Tags, Video Tags, Google Adsense on cleansweepchimneyservicesllc.com, however, there are 1 H1 Tags, 5 H2 Tags, 7 H3 Tags, 13 Paragraph Tags, 17 Image Tags, 53 Div Tags, and Google Analytics available.
| H1 Heading | 1 |
|---|---|
| H3 Heading | 7 |
| H5 Heading | Not Applicable |
| P Tag | 13 |
| Total IFRAMEs | Not Applicable |
| Audio | Not Applicable |
| Google Adsense | Not Applicable |
| H2 Heading | 5 |
|---|---|
| H4 Heading | Not Applicable |
| H6 Heading | Not Applicable |
| Total Images | 17 |
| Div Tag | 53 |
| Video | Not Applicable |
| Google Analytics | AVAILABLE |
HTTP Header Analysis
Following is the HTTP Header Analyis of www.cleansweepchimneyservicesllc.com
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| cleansweepchimneyservicesllc.com | A | 43200 | IP : 216.70.123.129 |
| cleansweepchimneyservicesllc.com | NS | 43200 | Target : ns1.mediatemple.net |
| cleansweepchimneyservicesllc.com | NS | 43200 | Target : ns2.mediatemple.net |
| cleansweepchimneyservicesllc.com | SOA | 43200 |
MNAME : ns1.mediatemple.net RNAME : dnsadmin.mediatemple.net Serial : 2020072901 Refresh : 10800 Retry : 3600 Expire : 1209600 Minimum TTL : 43200 |
| cleansweepchimneyservicesllc.com | MX | 43200 | Target : ASPMX.L.GOOGLE.com |
| cleansweepchimneyservicesllc.com | MX | 43200 | Target : ALT3.ASPMX.L.GOOGLE.com |
| cleansweepchimneyservicesllc.com | MX | 43200 | Target : ALT2.ASPMX.L.GOOGLE.com |
| cleansweepchimneyservicesllc.com | MX | 43200 | Target : ALT1.ASPMX.L.GOOGLE.com |
| cleansweepchimneyservicesllc.com | MX | 43200 | Target : ALT4.ASPMX.L.GOOGLE.com |
| cleansweepchimneyservicesllc.com | TXT | 43200 | Text : lii028j11e1tqh22efois7js8k |
| cleansweepchimneyservicesllc.com | TXT | 43200 | Text : notokenfound |
| cleansweepchimneyservicesllc.com | TXT | 43200 | Text : v=spf1 a mx include:_spf.google.com ~all |