textileprintingmachine.net - Detailed Indepth Information and Report for textileprintingmachine.net server location, textileprintingmachine.net website speed, textileprintingmachine.net website DNS lookup, textileprintingmachine.net Domain Details,textileprintingmachine.net social account information, etc. Complete Analysis of textileprintingmachine.net SEO like Meta Tags, Meta Keywords, Description, image count etc.
Web Analysis for textileprintingmachine - textileprintingmachine.net
| Page URL : | https://textileprintingmachine.net/ |
|---|---|
| Page Download Size : | 153.4824 Kb |
| Page Load Time : | 0.0162 Sec |
| Download Speed : | 9.2522 Mbps |
Chief Manufacturer of Textile Printing Machine - Textile Screen Printing Machine, Flat Bed & Roto Flat Screen Printing Machine in Ahmedabad, Gujarat, India offered by Screenotex..During our test, textileprintingmachine.net was downloaded in 0.0162 seconds. The homepage of the website is of 153.4824 Kb. The homepage was downloaded at the speed of 9.2522 Mbps, which is on the lower side.
textileprintingmachine.net business details :
We could not found details of the business associated with the website textileprintingmachine.net
Website Rank & Score to textileprintingmachine.net by Global & Country
The AuraStats, which measures best global as well country Alexa ranking performace of textileprintingmachine.net. textileprintingmachine.net ranks is not applicable. textileprintingmachine.net is not a top rated website as per Alexa Ranking. The website textileprintingmachine.net does not rank amongst top 1 million websites globally or in its country.
| Global Alexa Rank | Not Applicable |
|---|---|
| Country Alexa Rank | Not Applicable |
Web Server Information - textileprintingmachine.net
textileprintingmachine.net is hosted on Server 101.53.147.104 in E2E Networks Private Limited Data Center. Approximate latitude and logitude of the IP 101.53.147.104 are 28.466669082642 and 77.033332824707 respectively. textileprintingmachine.net is hosted in Gurgaon, Haryana, India.
| Hosted IP Address | 101.53.147.104 |
|---|---|
| Hosted Country | India |
| Location Latitude | 28.466669082642 |
| Location Longitude | 77.033332824707 |
| Server ISP | E2E Networks Private Limited |
| Server Region | Haryana |
| Server City | Gurgaon |
Page Title of textileprintingmachine.net
Textile Printing Machine, Manufacturer, Supplier in India | Best Price
Meta Tags of textileprintingmachine.net
Upon analysing the homepage of textileprintingmachine.net, we found the following meta keywords - textile printing machine, textile printing machine manufacturer, exporter, supplier, textile printing machine india, textile screen printing machine, textile screen printing machine manufacturer, textile screen printing machine supplier, textile screen printing machine exporter, textile screen printing machine india, rotary textile printing machine, bed screen printing machine, flat screen printing machine, roto flat screen printing machine, manufacturer, supplier, exporter, ahmedabad, gujarat, india.
Meta Author of textileprintingmachine.net is Textile Printing Machine India, https://textileprintingmachine.net/.
Meta Viewport of textileprintingmachine.net is Mobile Optimized.
We could not find Meta Generator, Meta Framework, Meta Theme-Color, Meta Ms-App, Meta Format Detection for textileprintingmachine.net
| Meta Keywords | textile printing machine, textile printing machine manufacturer, exporter, supplier, textile printing machine india, textile screen printing machine, textile screen printing machine manufacturer, textile screen printing machine supplier, textile screen printing machine exporter, textile screen printing machine india, rotary textile printing machine, bed screen printing machine, flat screen printing machine, roto flat screen printing machine, manufacturer, supplier, exporter, ahmedabad, gujarat, india |
|---|---|
| Meta Author | Textile Printing Machine India, https://textileprintingmachine.net/ |
| Meta Generator | Not Applicable |
| Meta Viewport | Mobile Optimized |
| Meta Framework | Not Applicable |
| Meta Theme Color | Not Applicable |
| Meta MS-App | Not Applicable |
| Meta Format Detection | Not Applicable |
Social Accounts
We could not find Facebook URL, Youtube URL, Instagram URL, Lindedin URL for textileprintingmachine.net
| Facebook Link |
|---|
| Not Available |
| Youtube Link |
| Not Available |
| Instagram Link |
| Not Available |
| Linkedin Link |
| Not Available |
Contact Information - textileprintingmachine.net
| Contact Number |
|---|
| We could not find any contact number for textileprintingmachine.net. To find contact number of textileprintingmachine.net, we recommend you visit textileprintingmachine.net and find it there. |
| Email Address |
|---|
| We could not find any Email ID for textileprintingmachine.net |
Domain TYPOS
Some common domain name typos of textileprintingmachine.net are as follows:
Website Inpage Analysis
We didn't find any H6 Tags, Audio Tags, Video Tags, Google Adsense, Google Analytics on textileprintingmachine.net, however, there are 1 H1 Tags, 1 H2 Tags, 8 H3 Tags, 6 H4 Tags, 3 H5 Tags, 41 Paragraph Tags, 1 Iframe Tags, 14 Image Tags, 93 Div Tags.
| H1 Heading | 1 |
|---|---|
| H3 Heading | 8 |
| H5 Heading | 3 |
| P Tag | 41 |
| Total IFRAMEs | 1 |
| Audio | Not Applicable |
| Google Adsense | Not Applicable |
| H2 Heading | 1 |
|---|---|
| H4 Heading | 6 |
| H6 Heading | Not Applicable |
| Total Images | 14 |
| Div Tag | 93 |
| Video | Not Applicable |
| Google Analytics | Not Applicable |
HTTP Header Analysis
Following is the HTTP Header Analyis of textileprintingmachine.net
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| textileprintingmachine.net | A | 86400 | IP : 101.53.147.104 |
| textileprintingmachine.net | NS | 86400 | Target : ns2.vwebdesigning.com |
| textileprintingmachine.net | NS | 86400 | Target : ns1.vwebdesigning.com |
| textileprintingmachine.net | SOA | 86400 |
MNAME : ns1.vwebdesigning.com RNAME : textileprintingmachine.vinayakinfosoft.com Serial : 2021021001 Refresh : 10800 Retry : 3600 Expire : 604800 Minimum TTL : 10800 |
| textileprintingmachine.net | MX | 86400 | Target : mail.textileprintingmachine.net |
| textileprintingmachine.net | TXT | 86400 | Text : v=spf1 +a +mx +a:host.vwebdesigning.com -all |