textileprintingmachine.net - Detailed Indepth Information and Report for textileprintingmachine.net server location, textileprintingmachine.net website speed, textileprintingmachine.net website DNS lookup, textileprintingmachine.net Domain Details,textileprintingmachine.net social account information, etc. Complete Analysis of textileprintingmachine.net SEO like Meta Tags, Meta Keywords, Description, image count etc.

Web Analysis for textileprintingmachine - textileprintingmachine.net

Page URL : https://textileprintingmachine.net/
Page Download Size : 153.4834 Kb
Page Load Time : 0.0580 Sec
Download Speed : 2.5842 Mbps

Chief Manufacturer of Textile Printing Machine - Textile Screen Printing Machine, Flat Bed & Roto Flat Screen Printing Machine in Ahmedabad, Gujarat, India offered by Screenotex..During our test, textileprintingmachine.net was downloaded in 0.0580 seconds. The homepage of the website is of 153.4834 Kb. The homepage was downloaded at the speed of 2.5842 Mbps, which is on the lower side.

textileprintingmachine.net business details :

We could not found details of the business associated with the website textileprintingmachine.net

Website Rank & Score to textileprintingmachine.net by Global & Country

The AuraStats, which measures best global as well country Alexa ranking performace of textileprintingmachine.net. textileprintingmachine.net ranks is not applicable. textileprintingmachine.net is not a top rated website as per Alexa Ranking. The website textileprintingmachine.net does not rank amongst top 1 million websites globally or in its country.

Global Alexa Rank

Not Applicable

Country Alexa Rank

Not Applicable

Web Server Information - textileprintingmachine.net

textileprintingmachine.net is hosted on Server 101.53.147.104 in E2E Networks Private Limited Data Center. Approximate latitude and logitude of the IP 101.53.147.104 are 28.466669082642 and 77.033332824707 respectively. textileprintingmachine.net is hosted in Gurgaon, Haryana, India.

Hosted IP Address

101.53.147.104

Hosted Country

India

Location Latitude

28.466669082642

Location Longitude

77.033332824707

Server ISP

E2E Networks Private Limited

Server Region

Haryana

Server City

Gurgaon

Page Title of textileprintingmachine.net

Textile Printing Machine, Manufacturer, Supplier in India | Best Price

Meta Tags of textileprintingmachine.net

Upon analysing the homepage of textileprintingmachine.net, we found the following meta keywords - textile printing machine, textile printing machine manufacturer, exporter, supplier, textile printing machine india, textile screen printing machine, textile screen printing machine manufacturer, textile screen printing machine supplier, textile screen printing machine exporter, textile screen printing machine india, rotary textile printing machine, bed screen printing machine, flat screen printing machine, roto flat screen printing machine, manufacturer, supplier, exporter, ahmedabad, gujarat, india.

Meta Author of textileprintingmachine.net is Textile Printing Machine India, https://textileprintingmachine.net/.

Meta Viewport of textileprintingmachine.net is Mobile Optimized.

We could not find Meta Generator, Meta Framework, Meta Theme-Color, Meta Ms-App, Meta Format Detection for textileprintingmachine.net

Meta Keywords

textile printing machine, textile printing machine manufacturer, exporter, supplier, textile printing machine india, textile screen printing machine, textile screen printing machine manufacturer, textile screen printing machine supplier, textile screen printing machine exporter, textile screen printing machine india, rotary textile printing machine, bed screen printing machine, flat screen printing machine, roto flat screen printing machine, manufacturer, supplier, exporter, ahmedabad, gujarat, india

Meta Author

Textile Printing Machine India, https://textileprintingmachine.net/

Meta Generator

Not Applicable

Meta Viewport

Mobile Optimized

Meta Framework

Not Applicable

Meta Theme Color

Not Applicable

Meta MS-App

Not Applicable

Meta Format Detection

Not Applicable

Social Accounts

We could not find Facebook URL, Youtube URL, Instagram URL, Lindedin URL for textileprintingmachine.net

Facebook Link
Not Available
Youtube Link
Not Available
Instagram Link
Not Available
Linkedin Link
Not Available

Contact Information - textileprintingmachine.net

Contact Number
We could not find any contact number for textileprintingmachine.net. To find contact number of textileprintingmachine.net, we recommend you visit textileprintingmachine.net and find it there.
Email Address
We could not find any Email ID for textileprintingmachine.net

Domain TYPOS

Some common domain name typos of textileprintingmachine.net are as follows:

Website Inpage Analysis

We didn't find any H6 Tags, Audio Tags, Video Tags, Google Adsense, Google Analytics on textileprintingmachine.net, however, there are 1 H1 Tags, 1 H2 Tags, 8 H3 Tags, 6 H4 Tags, 3 H5 Tags, 41 Paragraph Tags, 1 Iframe Tags, 14 Image Tags, 93 Div Tags.

H1 Heading

1

H3 Heading

8

H5 Heading

3

P Tag

41

Total IFRAMEs

1

Audio

Not Applicable

Google Adsense

Not Applicable

H2 Heading

1

H4 Heading

6

H6 Heading

Not Applicable

Total Images

14

Div Tag

93

Video

Not Applicable

Google Analytics

Not Applicable

HTTP Header Analysis

Following is the HTTP Header Analyis of textileprintingmachine.net

DNS Record Analysis

Host Type TTL Extra
textileprintingmachine.net A 86400 IP : 101.53.147.104
textileprintingmachine.net NS 86400 Target : ns2.vwebdesigning.com
textileprintingmachine.net NS 86400 Target : ns1.vwebdesigning.com
textileprintingmachine.net SOA 86400 MNAME : ns1.vwebdesigning.com
RNAME : textileprintingmachine.vinayakinfosoft.com
Serial : 2021021001
Refresh : 10800
Retry : 3600
Expire : 604800
Minimum TTL : 10800
textileprintingmachine.net MX 86400 Target : mail.textileprintingmachine.net
textileprintingmachine.net TXT 86400 Text : v=spf1 +a +mx +a:host.vwebdesigning.com -all