www.vishwakarmaelectricalappliances.com - Detailed Indepth Information and Report for www.vishwakarmaelectricalappliances.com server location, www.vishwakarmaelectricalappliances.com website speed, www.vishwakarmaelectricalappliances.com website DNS lookup, www.vishwakarmaelectricalappliances.com Domain Details,www.vishwakarmaelectricalappliances.com social account information, etc. Complete Analysis of www.vishwakarmaelectricalappliances.com SEO like Meta Tags, Meta Keywords, Description, image count etc.

Web Analysis for vishwakarmaelectricalappliances - www.vishwakarmaelectricalappliances.com

Page URL : http://www.vishwakarmaelectricalappliances.com/
Page Download Size : 290.2471 Kb
Page Load Time : 0.0383 Sec
Download Speed : 7.4006 Mbps

VISHWAKARMA ELECTRIC APPLIANCES - Manufacturer,Supplier Of Electric Appliances,Electrical Goods,Home Appliances In New Delhi,India.During our test, www.vishwakarmaelectricalappliances.com was downloaded in 0.0383 seconds. The homepage of the website is of 290.2471 Kb. The homepage was downloaded at the speed of 7.4006 Mbps, which is on the lower side.

www.vishwakarmaelectricalappliances.com business details :

We could not found details of the business associated with the website www.vishwakarmaelectricalappliances.com

Website Rank & Score to vishwakarmaelectricalappliances.com by Global & Country

The AuraStats, which measures best global as well country Alexa ranking performace of www.vishwakarmaelectricalappliances.com. www.vishwakarmaelectricalappliances.com ranks is not applicable. www.vishwakarmaelectricalappliances.com is not a top rated website as per Alexa Ranking. The website www.vishwakarmaelectricalappliances.com does not rank amongst top 1 million websites globally or in its country.

Global Alexa Rank

Not Applicable

Country Alexa Rank

Not Applicable

Web Server Information - www.vishwakarmaelectricalappliances.com

vishwakarmaelectricalappliances.com is hosted on Server 35.200.209.64 in Google LLC Data Center. Approximate latitude and logitude of the IP 35.200.209.64 are 37.405990600586 and -122.07851409912 respectively. vishwakarmaelectricalappliances.com is hosted in Mountain View, California, United States.

Hosted IP Address

35.200.209.64

Hosted Country

United States

Location Latitude

37.405990600586

Location Longitude

-122.07851409912

Server ISP

Google LLC

Server Region

California

Server City

Mountain View

Page Title of www.vishwakarmaelectricalappliances.com

Electric Appliances Manufacturer In New Delhi,Electrical Goods Supplier,India

Meta Tags of www.vishwakarmaelectricalappliances.com

Upon analysing the homepage of www.vishwakarmaelectricalappliances.com, we found the following meta keywords - Electric Appliances,Electrical Goods,Home Appliances.

Meta Viewport of www.vishwakarmaelectricalappliances.com is Mobile Optimized.

We could not find Meta Author, Meta Generator, Meta Framework, Meta Theme-Color, Meta Ms-App, Meta Format Detection for www.vishwakarmaelectricalappliances.com

Meta Keywords

Electric Appliances,Electrical Goods,Home Appliances

Meta Author

Not Applicable

Meta Generator

Not Applicable

Meta Viewport

Mobile Optimized

Meta Framework

Not Applicable

Meta Theme Color

Not Applicable

Meta MS-App

Not Applicable

Meta Format Detection

Not Applicable

Social Accounts

We could not find Facebook URL, Youtube URL, Instagram URL, Lindedin URL for www.vishwakarmaelectricalappliances.com

Facebook Link
Not Available
Youtube Link
Not Available
Instagram Link
Not Available
Linkedin Link
Not Available

Contact Information - vishwakarmaelectricalappliances.com

Contact Number
We have detected the Contact Number for vishwakarmaelectricalappliances.com as follows:
8037400891
Email Address
We could not find any Email ID for vishwakarmaelectricalappliances.com

Domain TYPOS

Some common domain name typos of vishwakarmaelectricalappliances.com are as follows:

Website Inpage Analysis

We didn't find any H3 Tags, H4 Tags, H5 Tags, H6 Tags, Audio Tags, Google Adsense on vishwakarmaelectricalappliances.com, however, there are 1 H1 Tags, 1 H2 Tags, 5 Paragraph Tags, 1 Iframe Tags, 13 Image Tags, 118 Div Tags, 1 Video Tags, and Google Analytics available.

H1 Heading

1

H3 Heading

Not Applicable

H5 Heading

Not Applicable

P Tag

5

Total IFRAMEs

1

Audio

Not Applicable

Google Adsense

Not Applicable

H2 Heading

1

H4 Heading

Not Applicable

H6 Heading

Not Applicable

Total Images

13

Div Tag

118

Video

1

Google Analytics

AVAILABLE

HTTP Header Analysis

Following is the HTTP Header Analyis of www.vishwakarmaelectricalappliances.com