www.vishwakarmaelectricalappliances.com - Detailed Indepth Information and Report for www.vishwakarmaelectricalappliances.com server location, www.vishwakarmaelectricalappliances.com website speed, www.vishwakarmaelectricalappliances.com website DNS lookup, www.vishwakarmaelectricalappliances.com Domain Details,www.vishwakarmaelectricalappliances.com social account information, etc. Complete Analysis of www.vishwakarmaelectricalappliances.com SEO like Meta Tags, Meta Keywords, Description, image count etc.
Web Analysis for vishwakarmaelectricalappliances - www.vishwakarmaelectricalappliances.com
| Page URL : | http://www.vishwakarmaelectricalappliances.com/ |
|---|---|
| Page Download Size : | 290.2471 Kb |
| Page Load Time : | 0.0402 Sec |
| Download Speed : | 7.0509 Mbps |
VISHWAKARMA ELECTRIC APPLIANCES - Manufacturer,Supplier Of Electric Appliances,Electrical Goods,Home Appliances In New Delhi,India.During our test, www.vishwakarmaelectricalappliances.com was downloaded in 0.0402 seconds. The homepage of the website is of 290.2471 Kb. The homepage was downloaded at the speed of 7.0509 Mbps, which is on the lower side.
www.vishwakarmaelectricalappliances.com business details :
We could not found details of the business associated with the website www.vishwakarmaelectricalappliances.com
Website Rank & Score to vishwakarmaelectricalappliances.com by Global & Country
The AuraStats, which measures best global as well country Alexa ranking performace of www.vishwakarmaelectricalappliances.com. www.vishwakarmaelectricalappliances.com ranks is not applicable. www.vishwakarmaelectricalappliances.com is not a top rated website as per Alexa Ranking. The website www.vishwakarmaelectricalappliances.com does not rank amongst top 1 million websites globally or in its country.
| Global Alexa Rank | Not Applicable |
|---|---|
| Country Alexa Rank | Not Applicable |
Web Server Information - www.vishwakarmaelectricalappliances.com
vishwakarmaelectricalappliances.com is hosted on Server 35.200.209.64 in Google LLC Data Center. Approximate latitude and logitude of the IP 35.200.209.64 are 37.405990600586 and -122.07851409912 respectively. vishwakarmaelectricalappliances.com is hosted in Mountain View, California, United States.
| Hosted IP Address | 35.200.209.64 |
|---|---|
| Hosted Country | United States |
| Location Latitude | 37.405990600586 |
| Location Longitude | -122.07851409912 |
| Server ISP | Google LLC |
| Server Region | California |
| Server City | Mountain View |
Page Title of www.vishwakarmaelectricalappliances.com
Electric Appliances Manufacturer In New Delhi,Electrical Goods Supplier,India
Meta Tags of www.vishwakarmaelectricalappliances.com
Upon analysing the homepage of www.vishwakarmaelectricalappliances.com, we found the following meta keywords - Electric Appliances,Electrical Goods,Home Appliances.
Meta Viewport of www.vishwakarmaelectricalappliances.com is Mobile Optimized.
We could not find Meta Author, Meta Generator, Meta Framework, Meta Theme-Color, Meta Ms-App, Meta Format Detection for www.vishwakarmaelectricalappliances.com
| Meta Keywords | Electric Appliances,Electrical Goods,Home Appliances |
|---|---|
| Meta Author | Not Applicable |
| Meta Generator | Not Applicable |
| Meta Viewport | Mobile Optimized |
| Meta Framework | Not Applicable |
| Meta Theme Color | Not Applicable |
| Meta MS-App | Not Applicable |
| Meta Format Detection | Not Applicable |
Social Accounts
We could not find Facebook URL, Youtube URL, Instagram URL, Lindedin URL for www.vishwakarmaelectricalappliances.com
| Facebook Link |
|---|
| Not Available |
| Youtube Link |
| Not Available |
| Instagram Link |
| Not Available |
| Linkedin Link |
| Not Available |
Contact Information - vishwakarmaelectricalappliances.com
| Contact Number |
|---|
| We have detected the Contact Number for vishwakarmaelectricalappliances.com as follows: |
| 8037400891 |
| Email Address |
|---|
| We could not find any Email ID for vishwakarmaelectricalappliances.com |
Domain TYPOS
Some common domain name typos of vishwakarmaelectricalappliances.com are as follows:
Website Inpage Analysis
We didn't find any H3 Tags, H4 Tags, H5 Tags, H6 Tags, Audio Tags, Google Adsense on vishwakarmaelectricalappliances.com, however, there are 1 H1 Tags, 1 H2 Tags, 5 Paragraph Tags, 1 Iframe Tags, 13 Image Tags, 118 Div Tags, 1 Video Tags, and Google Analytics available.
| H1 Heading | 1 |
|---|---|
| H3 Heading | Not Applicable |
| H5 Heading | Not Applicable |
| P Tag | 5 |
| Total IFRAMEs | 1 |
| Audio | Not Applicable |
| Google Adsense | Not Applicable |
| H2 Heading | 1 |
|---|---|
| H4 Heading | Not Applicable |
| H6 Heading | Not Applicable |
| Total Images | 13 |
| Div Tag | 118 |
| Video | 1 |
| Google Analytics | AVAILABLE |
HTTP Header Analysis
Following is the HTTP Header Analyis of www.vishwakarmaelectricalappliances.com